PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv1_010150_oexy.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 216aa    MW: 25320.8 Da    PI: 6.7971
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv1_010150_oexy.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.46.9e-27958150
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        krien++nrqvt+skRrng++KKA E+ vLCda+v+v+if+++gk++ y 
  Bv1_010150_oexy.t1  9 KRIENSTNRQVTYSKRRNGLIKKATEITVLCDAKVSVVIFANNGKMHAYN 58
                        79*********************************************996 PP

2K-box79.21e-2671165195
               K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                         y++ + k+l++ak+e+l++e++++kke+enLq e+Rhl+Ged+ sL + eL++Le++L++++  iR+k++e++ ++ +++ + e+e ++ n
  Bv1_010150_oexy.t1  71 YHEITRKRLWDAKHENLSNEIDRIKKENENLQIELRHLKGEDVASLAYPELMRLEDALQNGIAGIRDKQMEIYAMHKKNTTMLEEEENQLN 161
                         67778899*********************************************************************************** PP

               K-box  92 kaLr 95 
                          +L+
  Bv1_010150_oexy.t1 162 YMLH 165
                         9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.455161IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-37160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-34296IPR002100Transcription factor, MADS-box
CDDcd002656.01E-38280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-27323IPR002100Transcription factor, MADS-box
PfamPF003197.6E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.1E-1782164IPR002487Transcription factor, K-box
PROSITE profilePS5129713.44484170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT YSKRRNGLIK KATEITVLCD AKVSVVIFAN NGKMHAYNSP  60
STTVEDILES YHEITRKRLW DAKHENLSNE IDRIKKENEN LQIELRHLKG EDVASLAYPE  120
LMRLEDALQN GIAGIRDKQM EIYAMHKKNT TMLEEEENQL NYMLHCLHKQ EIMDADIREM  180
NGSVCNNTAE ERDYHYHQMP FGFRVQPMQP NLQERM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J2e-15289180Myocyte-specific enhancer factor 2A
3p57_I2e-15289180Myocyte-specific enhancer factor 2A
3p57_D2e-15289180Myocyte-specific enhancer factor 2A
3p57_C2e-15289180Myocyte-specific enhancer factor 2A
3p57_B2e-15289180Myocyte-specific enhancer factor 2A
3p57_A2e-15289180Myocyte-specific enhancer factor 2A
3kov_J2e-15289180Myocyte-specific enhancer factor 2A
3kov_I2e-15289180Myocyte-specific enhancer factor 2A
3kov_B2e-15289180Myocyte-specific enhancer factor 2A
3kov_A2e-15289180Myocyte-specific enhancer factor 2A
1tqe_S2e-15189181Myocyte-specific enhancer factor 2B
1tqe_R2e-15189181Myocyte-specific enhancer factor 2B
1tqe_Q2e-15189181Myocyte-specific enhancer factor 2B
1tqe_P2e-15189181Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010677661.11e-162PREDICTED: floral homeotic protein PMADS 2-like
SwissprotQ074743e-94MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLA0A0J8D2H61e-162A0A0J8D2H6_BETVU; Uncharacterized protein
STRINGVIT_18s0001g01760.t016e-94(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.12e-78MIKC_MADS family protein